PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03712.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 284aa    MW: 32086 Da    PI: 5.8479
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03712.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-182168148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT +Ed ll+++++ +G g+W++ a++ g++Rt+k+c++rw++yl
  mrna03712.1-v1.0-hybrid 21 KGPWTLDEDTLLIHYIENHGEGHWNALAKCAGLKRTGKSCRLRWLNYL 68
                             79********************************************97 PP

2Myb_DNA-binding52.89.4e-1774117146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  mrna03712.1-v1.0-hybrid  74 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7941668IPR017930Myb domain
SuperFamilySSF466895.62E-3119115IPR009057Homeodomain-like
SMARTSM007177.3E-152070IPR001005SANT/Myb domain
PfamPF002491.9E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-232275IPR009057Homeodomain-like
CDDcd001671.80E-112368No hitNo description
PROSITE profilePS5129425.75169123IPR017930Myb domain
SMARTSM007172.7E-1573121IPR001005SANT/Myb domain
PfamPF002499.3E-1674117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2376122IPR009057Homeodomain-like
CDDcd001678.44E-1278117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MAGVANSASI SPNEEENELR KGPWTLDEDT LLIHYIENHG EGHWNALAKC AGLKRTGKSC  60
RLRWLNYLKP DIKRGNLTPQ EQLLILELHS KWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KQARQLNIES NSQRFLDAVR CFWMPTLRQK MEQTSLSLDP SPSPSSYLTS HISAAPTPPP  180
PSKMVSHVSD YSLIGNSCPS HNSPSESLIS QLPQIPEQPA SSSYAFEALN DSYYVDYDMG  240
GLVLDPVSEM ASFDASQFDC QMTESDWMSN NYMTDTLWNM QGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251812324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9674430.0GU967443.1 Rosa rugosa putative MYB transcription factor (MYB4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299054.10.0PREDICTED: transcription factor MYB24
TrEMBLD6PT031e-168D6PT03_R
STRINGGLYMA10G41930.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.17e-85myb domain protein 62